PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g23365.1.p
Common NameBRADI_3g23365
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family HD-ZIP
Protein Properties Length: 268aa    MW: 30645.3 Da    PI: 7.4497
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g23365.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox54.42.2e-175471456
                      HHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox 14 eLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                      +L +lF+++++p++++r+eL+++l+L+ rqVk+WFqNrR+++k
  Bradi3g23365.1.p  5 ALCRLFKECPHPDEKQRAELSMRLSLDARQVKFWFQNRRTQMK 47
                      6889************************************999 PP

2START69.87.6e-2312422344132
                       CEEEEEEEECCSCH.HHHHHHHHCCCGGCT-TT-S....EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EE CS
             START  44 sgealrasgvvdmv.lallveellddkeqWdetla....kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwv 124
                         ea+r+sg+v+ + ++ lve+l+d + +W+ ++     ka++le +s+g      g l lm+aelq+lsplvp R++ f+ +++ql +g w+
  Bradi3g23365.1.p 124 VFEASRESGLVIIDnSVALVETLMDER-RWSDMFScmiaKATILEEVSTGiagsrnGSLLLMKAELQVLSPLVPiREVIFLMFCKQLAEGAWA 215
                       679******998651669*********.***************************************************************** PP

                       EEEEEEE- CS
             START 125 ivdvSvds 132
                       +vdvS+d 
  Bradi3g23365.1.p 216 VVDVSIDG 223
                       ******95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003892.0E-7153IPR001356Homeobox domain
PROSITE profilePS5007114.544149IPR001356Homeobox domain
PfamPF000467.4E-15547IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.5E-15551IPR009057Homeodomain-like
SuperFamilySSF466896.42E-14549IPR009057Homeodomain-like
CDDcd000865.40E-12849No hitNo description
PROSITE patternPS0002702447IPR017970Homeobox, conserved site
PfamPF018523.8E-17123222IPR002913START domain
PROSITE profilePS5084816.37126222IPR002913START domain
SuperFamilySSF559613.3E-11126226No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MDSSALCRLF KECPHPDEKQ RAELSMRLSL DARQVKFWFQ NRRTQMKTQL ERGTQLERHE  60
NALLKQENDK LYGSTYALRM HGSRMNSTES VPLPPSSLAN LYSSYFEEYH FFLPGMGMKP  120
AGFVFEASRE SGLVIIDNSV ALVETLMDER RWSDMFSCMI AKATILEEVS TGIAGSRNGS  180
LLLMKAELQV LSPLVPIREV IFLMFCKQLA EGAWAVVDVS IDGLMRDQNS VLRNSNAYLR  240
IFWTTLDNWR VLGISYAYLR RFQNSLD*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF8574841e-112KF857484.1 Avena strigosa cultivar S75 homeobox-leucine zipper protein (HDZ1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003570085.18e-77PREDICTED: homeobox-leucine zipper protein ROC5
SwissprotQ6EPF08e-71ROC5_ORYSJ; Homeobox-leucine zipper protein ROC5
TrEMBLA0A0Q3JDX20.0A0A0Q3JDX2_BRADI; Uncharacterized protein
STRINGBRADI3G51540.13e-76(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52170.15e-50homeodomain GLABROUS 7